| consensus {seqinr} | R Documentation |
This function returns a consensus using variuous methods (see details) or a profile from a sequence alignment.
consensus(matali, method = c( "majority", "threshold", "IUPAC", "profile"),
threshold = 0.60, warn.non.IUPAC = FALSE, type = c("DNA", "RNA"))
con(matali, method = c( "majority", "threshold", "IUPAC", "profile"),
threshold = 0.60, warn.non.IUPAC = FALSE, type = c("DNA", "RNA"))
matali |
an object of class |
method |
select the method to use, see details. |
threshold |
for the |
warn.non.IUPAC |
for the |
type |
for the |
The character with the higher frequency is returned as the consensus character.
As above but in addition the character relative frequency
must be higher than the value controled by the threshold argument.
If none, NA id returned.
Make sense only for nucleic acid sequences (DNA or RNA).
The consensus character is defined if possible by an IUPAC symbol by
function bma. If this is not possible, when there is a gap
character for instance, NA is returned.
With this method a matrix with the count of each possible character at each position is returned.
con is a short form for consensus.
Either a vector of single characters with possible NA or a matrix with
the method profile.
J.R. Lobry
citation("seqinr")
See read.alignment to import alignment from files.
#
# Read 5 aligned DNA sequences at 42 sites:
#
phylip <- read.alignment(file = system.file("sequences/test.phylip",
package = "seqinr"), format = "phylip")
#
# Show data in a matrix form:
#
(matali <- as.matrix(phylip))
#
# With the majority rule:
#
res <- consensus(phylip)
stopifnot(c2s(res) == "aaaccctggccgttcagggtaaaccgtggccgggcagggtat")
#
# With a threshold:
#
res.thr <- consensus(phylip, method = "threshold")
res.thr[is.na(res.thr)] <- "." # change NA into dots
# stopifnot(c2s(res.thr) == "aa.c..t.gc.gtt..g..t.a.cc..ggccg.......ta.")
stopifnot(c2s(res.thr) == "aa.cc.tggccgttcagggtaaacc.tggccgg.cagggtat")
#
# With an IUPAC summary:
#
res.iup <- consensus(phylip, method = "IUPAC")
stopifnot(c2s(res.iup) == "amvsbnkkgcmkkkmmgsktrmrssndkgcmrkdmmvskyaw")
# replace 3 and 4-fold symbols by dots:
res.iup[match(res.iup, s2c("bdhvn"), nomatch = 0) > 0] <- "."
stopifnot(c2s(res.iup) == "am.s..kkgcmkkkmmgsktrmrss..kgcmrk.mm.skyaw")
#
# With a profile method:
#
(res <- consensus(phylip, method = "profile"))
#
# Show the connection between the profile and some consensus:
#
bxc <- barplot(res, col = c("green", "blue", "orange", "white", "red"), border = NA,
space = 0, las = 2, ylab = "Base count",
main = "Profile of a DNA sequence alignment",
xlab = "sequence position", xaxs = "i")
text(x = bxc, y = par("usr")[4],lab = res.thr, pos = 3, xpd = NA)
text(x = bxc, y = par("usr")[1],lab = res.iup, pos = 1, xpd = NA)